PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00193g03004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 460aa    MW: 50501.9 Da    PI: 6.8836
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00193g03004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-39105165262
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  Niben101Scf00193g03004.1 105 PDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGSGRRKNKSSS 165
                               7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31102162IPR003851Zinc finger, Dof-type
PfamPF027015.3E-32107163IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.593109163IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MSEVKLFGKT IHLPLDDLLD QRNSSAATTL HQDLITSEAD HTQSKNRDDF NNLTADEAVE  60
PETSSGRSDD PKKEDADNET SSPKATKKEE PNEANVTQEK ALKKPDKILP CPRCNSMETK  120
FCYYNNYNVN QPRHFCKKCQ RYWTAGGTMR NVPVGSGRRK NKSSSTTGYR HIMVSDALQE  180
ARFEAAHGMN LPMLRANRTV LAFGSDKPLC DSMASILNLA EKSQNSVQNG FNGSEQRTPS  240
ACGGKETGNN ISSGACSTAS NSTHDLAWKN FQAFPPQVHQ FPGHPWPYSY NAAPWTSAVP  300
QPNLAPPRFP VPFYPAPPYW GCTVASPWNV PWVSPPSSSP DCSVLSATPT SPTLGKHSRD  360
ECALNQSNSE KEDPLQDIDG ERAVLAPKTL RVDDPDEAAK SSIWSTLGIK NEKNDSTNGA  420
RLFKAFNSKV DLRNHESDAS LVLQANPAAL SRSLNFQEST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788566.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLM1BKM31e-175M1BKM3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000473701e-174(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.28e-87cycling DOF factor 2